PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002967G0190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 345aa    MW: 38130.1 Da    PI: 7.0119
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002967G0190genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092713062055
                      HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  PH01002967G0190 271 YKWPYPSETEKIVLAESTGLDQKQINNWFINQRKRH 306
                      4679*****************************885 PP

2ELK37.93.9e-13226247122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLl+KYsgyL+sL+qEFs
  PH01002967G0190 226 ELKYQLLKKYSGYLSSLRQEFS 247
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-2279123IPR005540KNOX1
PfamPF037902.0E-2280121IPR005540KNOX1
SMARTSM012565.0E-28126177IPR005541KNOX2
PfamPF037915.6E-24132176IPR005541KNOX2
SMARTSM011881.2E-7226247IPR005539ELK domain
PfamPF037894.1E-10226247IPR005539ELK domain
PROSITE profilePS5121311.627226246IPR005539ELK domain
PROSITE profilePS5007112.779246309IPR001356Homeobox domain
SuperFamilySSF466891.45E-19247320IPR009057Homeodomain-like
SMARTSM003895.4E-13248313IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-27251310IPR009057Homeodomain-like
CDDcd000868.10E-13258310No hitNo description
PfamPF059206.3E-17266305IPR008422Homeobox KN domain
PROSITE patternPS000270284307IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MDQSFGNLGA GGSNSSGSKA ASSSFLQLPL STAAATTAPM GGGAYYGAPL ALHHVAAGPS  60
QYQHHKHGTA GEISPAGAEA IKAKIMAHPQ YSALLAAYMD CQKVGAPPDV LERLTAMAAK  120
LDARPPGRHE PRDPELDQFM EAYCNMLVKY REELTRPIEE AMEYLKRVEA QLDSITGGGH  180
GHGSSSARFL LADGKSEGVG SSEDDLDPSG RENEPPEIDP RAEDKELKYQ LLKKYSGYLS  240
SLRQEFSKKK KKGKLPKEAR QKLLHWWEMH YKWPYPSETE KIVLAESTGL DQKQINNWFI  300
NQRKRHWKPS EDMPFVMMEG FHPQNAAALY MDGQFMADGM YRLGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0940390.0FP094039.1 Phyllostachys edulis cDNA clone: bphyem209e11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955415.10.0PREDICTED: homeobox protein rough sheath 1-like
SwissprotO650340.0KNOSC_ORYSI; Homeobox protein knotted-1-like 12
SwissprotO804160.0KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBLW5BCN70.0W5BCN7_WHEAT; Uncharacterized protein
STRINGMLOC_11678.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-106KNOTTED-like from Arabidopsis thaliana